PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 958aa    MW: 107617 Da    PI: 8.9042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009636genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.3e-11430472446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT +E++ll+ +v+  G ++W+ Ia+ + k+Rt+ qc +r+q 
      Lus10009636 430 WTRQEEKLLLYYVQSKGIHNWSEIASLLRKNRTPFQCLERYQR 472
                      *****************************************96 PP

2Myb_DNA-binding46.87e-15482524346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd +l+ av+++G  +W ++a t+  gRt+ qc +rw+k
      Lus10009636 482 EWTKEEDAQLKSAVRKFGESDWQSVATTLR-GRTGAQCSNRWLK 524
                      7*****************************.***********98 PP

3Myb_DNA-binding46.58.6e-15531575146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W +eEd++l+ avk +G+++Wk++a+ ++ gR + qc++rw++
      Lus10009636 531 KGHWKAEEDKRLKLAVKFFGPKDWKRVASFVP-GRKDVQCRERWHN 575
                      789*****************************.***********98 PP

4Myb_DNA-binding56.75.5e-18583627147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT+eEd +l+ av+++G   W++++++++ gRt+++c  rw  +
      Lus10009636 583 RGAWTAEEDSRLKAAVEEHGHS-WSKVSHYIP-GRTDNDCMRRWKVL 627
                      89******************88.*********.***********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.481326421IPR017877Myb-like domain
SMARTSM007170.27330423IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-12333349IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-12393428IPR009057Homeodomain-like
SuperFamilySSF466895.56E-18402472IPR009057Homeodomain-like
PROSITE profilePS500909.721422474IPR017877Myb-like domain
SMARTSM007177.3E-9426476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-12429475IPR009057Homeodomain-like
PfamPF139213.7E-13430491No hitNo description
SuperFamilySSF466891.17E-18459526IPR009057Homeodomain-like
PROSITE profilePS5129413.227475527IPR017930Myb domain
SMARTSM007175.4E-9479528IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-15481527IPR009057Homeodomain-like
CDDcd001675.68E-11482526No hitNo description
SMARTSM007178.6E-14530579IPR001005SANT/Myb domain
PROSITE profilePS5129413.347531577IPR017930Myb domain
PfamPF002494.5E-13531575IPR001005SANT/Myb domain
SuperFamilySSF466893.46E-26531624IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-20532584IPR009057Homeodomain-like
CDDcd001671.54E-11534575No hitNo description
PROSITE profilePS5129424.374578632IPR017930Myb domain
SMARTSM007171.1E-16582630IPR001005SANT/Myb domain
PfamPF002492.2E-16583626IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-18585628IPR009057Homeodomain-like
CDDcd001673.59E-12585628No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MRTPEAENGG GLSELTSDDE EDLNDALFND IEALRQVCLK TGNNLGDTVN FCDDDDDNDD  60
GPSTSGRVVD SDSDEDDLEI LRSIQQRFMK SGKNYQALSP KPLCSIHPDT DDDDGEDDIE  120
MLVSLQRRFG KNDANGGEIR SKRFEEEQTS IVTSEAKVAD EQLVGKTNAF RVVEDIEDTA  180
NNTANLLSDS IEMQPAGSVH ESASCQSSKS FINQEASQMI FGAIKKNRSL QNFIRTKMSQ  240
IKARLEENND LRKRVKILKD LQVSCRQNTG RSFAQGKNPR IQLISALSSI SSKDAKGKNV  300
KLSPICSGPE ENSHVPNYRE ALVKFPISLE RRKWEKSEDK KLKEGLKQQF QELLFMEATD  360
QFSSLGHDGD TDSIIKSVEN LEITPEIMKK FLHKVDWNMV ASRFVEGRSG PECQARWLNS  420
ACPDINNSGW TRQEEKLLLY YVQSKGIHNW SEIASLLRKN RTPFQCLERY QRSLNSCVLN  480
KEWTKEEDAQ LKSAVRKFGE SDWQSVATTL RGRTGAQCSN RWLKSLCVYG KGHWKAEEDK  540
RLKLAVKFFG PKDWKRVASF VPGRKDVQCR ERWHNACSPS LNRGAWTAEE DSRLKAAVEE  600
HGHSWSKVSH YIPGRTDNDC MRRWKVLFPK EVPLLKEARK IRNAALITNF VDREEERPAL  660
GLEDFVTSPL LGLLPESEKV DQSGKSSRKR SNAGTKTRPK RTVKQMQYSL QAGGNGTADA  720
GDAESCGGST AAGRKRRTVN RRRRMRKDHA EPPREPSPDS ICSPLRTTKV LLVYTRRKKG  780
LDLKNSRLNL SKEANSSTGK DVEAPSSFNE VSKKGIGALG PHHRHEKDSH HVQGPWDNTT  840
LSSLRTSKKR KRKLKIDDRS KIVVKDIGEA SYPPDDAQAT SYSEATISAE LQCRETSSHM  900
TIYNRRSPPG LISVDSRKRK KIHGQAPVNQ KNDDSKINDA GILRATSLDA CESDVTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-303966324159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-303966324159MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1740747RRRRMRKD
2847852KKRKRK
3916920RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000478.10.0PREDICTED: uncharacterized protein LOC105108037 isoform X3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-153myb domain protein 4r1